Edit |   |
---|---|
Antigenic Specificity | SH3KBP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SH3KBP1 polyclonal antibody, unconjugated |
Immunogen | SH3 KBP1 antibody was raised using the N terminal of SH3 BP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS |
Other Names | CD2BP3|CIN85|GIG10|HSB-1|HSB1|MIG18|CD2-binding protein 3|SH3 domain-containing kinase-binding protein 1|Src family kinase-binding protein 1|c-Cbl-interacting protein|cbl-interacting protein of 85 kDa|human Src family kinase-binding protein 1|migration-inducing gene 18|src-related kinase binding protein-1|SH3 domain containing kinase binding protein 1|SH3KBP1|SH3-Domain Kinase Binding Protein 1|Seta|SH3 domain-containing adapter protein|SH3-containing|expressed in tumorigenic astrocytes|regulator of ubiquitous kinase|ruk|SH3 domain-containing kinase-binding protein 1-like|LOC100551401|1200007H22Rik|1700125L08Rik|5830464D22Rik|AI447724|IN85|Sh3 containing|expressed in astrocytes|si:dkey-108d10.1 |
Gene, Accession # | Gene ID: 30011 |
Catalog # | ABIN633146 |
Price | $1020 |
Order / More Info | SH3KBP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |