Edit |   |
---|---|
Antigenic Specificity | A1CF |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-A1CF polyclonal antibody, unconjugated |
Immunogen | A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP |
Other Names | ACF|ACF64|ACF65|APOBEC1CF|ASP|APOBEC-1 stimulating protein|apo-B RNA editing protein|apobec-1 complementation factor (ACF) (ASP)|APOBEC1 complementation factor|A1CF|1810073H04Rik|APOBEC1-stimulating protein|apobec-1 complementation factor|A1cft|Apobec-1|APOBEC1 complementation factort|Apobec-1 complementation factor APOBEC-1 stimulating protein|APOBEC1 complementation factor L homeolog|a1cf.L |
Gene, Accession # | Gene ID: 29974 |
Catalog # | ABIN633338 |
Price | $1020 |
Order / More Info | A1CF Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |