Edit |   |
---|---|
Antigenic Specificity | RBP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RBP1 polyclonal antibody, unconjugated |
Immunogen | RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG |
Other Names | RBBP-1|RBBP1|RBP-1|RBP1|ARID domain-containing protein 4A|AT-rich interactive domain-containing protein 4A|retinoblastoma binding protein 1|retinoblastoma-binding protein 1|AT-rich interaction domain 4A|ARID4A|Retinol Binding Protein 1, Cellular|CRABP-I|CRBP|CRBP1|CRBPI|RBPC|CRBP-I|cellular retinol-binding protein I|retinol-binding protein 1|cellular|retinol binding protein 1|cb465|wu:fb75e07|zgc:73335|retinol binding protein 1a, cellular|rbp5|retinol binding protein 1 L homeolog|rbp1.L|cellular retinol binding protein 1|CRABP1|mCRBPI|LOW QUALITY PROTEIN: retinol-binding protein 1 |
Gene, Accession # | Gene ID: 5926, 19659 |
Catalog # | ABIN629847 |
Price | $902 |
Order / More Info | RBP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |