Edit |   |
---|---|
Antigenic Specificity | TXNIP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TXNIP polyclonal antibody, unconjugated |
Immunogen | TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP |
Other Names | EST01027|HHCPA78|THIF|VDUP1|thioredoxin binding protein 2|thioredoxin-binding protein 2|thioredoxin-interacting protein|upregulated by 1|25-dihydroxyvitamin D-3|vitamin D3 up-regulated protein 1|thioredoxin interacting protein|TXNIP|Gm348|Trf3|TATA box binding protein-like 2|TATA box-binding protein-like protein 2|TATA box-binding protein-related factor 3|TBP-like protein 2|TBP-related factor 3 (Trf3)|TATA box binding protein like 2|Tbpl2|TBP2|TBP-related factor 3|TATA-box binding protein like 2|1200008J08Rik|AA682105|Hyplip1|Tbp-2|hyperlipidemia 1|thioredoxin binding protein-2|thioredoxin interacting protein L homeolog|txnip.L|sb:cb368|thioredoxin interacting protein a|txnipa |
Gene, Accession # | Gene ID: 10628, 56338, 117514 |
Catalog # | ABIN630604 |
Price | $1020 |
Order / More Info | TXNIP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |