Edit |   |
---|---|
Antigenic Specificity | HINT1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HINT1 polyclonal antibody, unconjugated |
Immunogen | HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH |
Other Names | HINT|NMAN|PKCI-1|PRKCNH1|adenosine 5'-monophosphoramidase|histidine triad nucleotide-binding protein 1|protein kinase C inhibitor 1|protein kinase C-interacting protein 1|histidine triad nucleotide binding protein 1|HINT1|AA673479|Ipk1|PKC inhibitor interacting protein|17 kDa inhibitor of protein kinase C|Pkci|Prkci|protein kinase C|iota|CHPKCI|HINTZ|PKCIZ|histidine triad missing Z|protein kinase C inhibitor|histidine triad nucleotide binding protein 1-Z|HINT1Z|histidine triad nucleotide binding protein 1 S homeolog|hint1.S|zgc:103764|PKCI-Z-related protein|P13.7|hint-1 |
Gene, Accession # | Gene ID: 3094, 15254, 690660 |
Catalog # | ABIN632794 |
Price | $1020 |
Order / More Info | HINT1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |