Edit |   |
---|---|
Antigenic Specificity | WDR77 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-WDR77 polyclonal antibody, unconjugated |
Immunogen | WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS |
Other Names | MEP-50|MEP50|Nbla10071|RP11-552M11.3|p44|p44Mep50|WD repeat-containing protein 77|androgen receptor cofactor p44|methylosome protein 50|WD repeat domain 77|WDR77|2610003I18Rik|2610312E17Rik|C79984|RGD1310479|Ac2-269|valois|WD repeat domain 77 S homeolog|wdr77.S|methylosome protein 50-like|zgc:65780|zgc:77274 |
Gene, Accession # | Gene ID: 79084 |
Catalog # | ABIN630615 |
Price | $1020 |
Order / More Info | WDR77 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |