Edit |   |
---|---|
Antigenic Specificity | SPPL2B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SPPL2B polyclonal antibody, unconjugated |
Immunogen | SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
Other Names | IMP-4|IMP4|PSH4|PSL1|SPP-like 2B|intramembrane protease 4|presenilin homologous protein 4|presenilin-like protein 1|signal peptide peptidase-like 2B|signal peptide peptidase like 2B|SPPL2B|3110056O03Rik|AW550292|protein SPP-like 2B|protein SPPL2b|wu:fc16e01|wu:fc85d12|zgc:136525|signal peptide peptidase-like protein 2|signal peptide peptidase-like 2|sppl2|RGD1308556|signal peptide peptidase like 2B S homeolog|sppl2b.S|MGC147524 |
Gene, Accession # | Gene ID: 56928 |
Catalog # | ABIN634985 |
Price | $1020 |
Order / More Info | SPPL2B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |