Edit |   |
---|---|
Antigenic Specificity | CDK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | arabidopsis, Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CDK1 polyclonal antibody, unconjugated |
Immunogen | CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Other Names | CDC2|CDC28A|P34CDC2|cell cycle controller CDC2|cell division control protein 2 homolog|cell division cycle 2|G1 to S and G2 to M|cell division protein kinase 1|p34 protein kinase|cyclin dependent kinase 1|CDK1|Cyclin-Dependent Kinase 1|cyclin dependent kinase like 1|CDKL1|Cell division control protein 2 1|POPTR_0004s14080g|Cdc2a|p34 |
Gene, Accession # | Gene ID: 983, 12534, 34411, 54237 |
Catalog # | ABIN634188 |
Price | $1020 |
Order / More Info | CDK1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |