Edit |   |
---|---|
Antigenic Specificity | RAB5B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RAB5B polyclonal antibody, unconjugated |
Immunogen | RAB5 B antibody was raised using the N terminal of RAB5 corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
Other Names | ras-related protein Rab-5B|RAB5B, member RAS oncogene family|RAB5B|zgc:76978|RAB5A member RAS oncogene family|member RAS oncogene family|LOC613071|C030027M18Rik|RAB5B, member RAS oncogene family L homeolog|rab5b.L |
Gene, Accession # | Gene ID: 5869, 19344, 288779 |
Catalog # | ABIN634446 |
Price | $1020 |
Order / More Info | RAB5B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |