Edit |   |
---|---|
Antigenic Specificity | NANP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NANP polyclonal antibody, unconjugated |
Immunogen | NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS |
Other Names | C20orf147|HDHD4|dJ694B14.3|N-acylneuraminate-9-phosphatase|Neu5Ac-9-Pase|haloacid dehalogenase-like hydrolase domain containing 4|haloacid dehalogenase-like hydrolase domain-containing protein 4|N-acetylneuraminic acid phosphatase|NANP|N-acetylneuraminic acid phosphatase L homeolog|nanp.L|rgd1306009|1600031M04Rik|zgc:111947 |
Gene, Accession # | Gene ID: 67311, 140838, 311530 |
Catalog # | ABIN632748 |
Price | $1020 |
Order / More Info | NANP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |