Edit |   |
---|---|
Antigenic Specificity | GJE1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GJE1 polyclonal antibody, unconjugated |
Immunogen | GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA |
Other Names | AEY12|Cx23|D230044M03Rik|Gjf1|Gsfaey12|connexin 23|connexin-23|gap junction epsilon-1 protein|putative gap junction protein connexin Cx43.4|gap junction protein, epsilon 1|Gje1|gap junction protein epsilon 1|RGD1308189 |
Gene, Accession # | Gene ID: 100126572 |
Catalog # | ABIN630271 |
Price | $902 |
Order / More Info | GJE1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |