Edit |   |
---|---|
Antigenic Specificity | LBP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LBP polyclonal antibody, unconjugated |
Immunogen | LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL |
Other Names | BPIFD2|BPI fold containing family D|member 2|LPS-binding protein|lipopolysaccharide-binding protein|lipopolysaccharide binding protein|LBP|Ly88|LPSBP|lipopolysaccharide-binding protein-like|LOC100472839 |
Gene, Accession # | Gene ID: 3929 |
Catalog # | ABIN634479 |
Price | $1020 |
Order / More Info | LBP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |