Edit |   |
---|---|
Antigenic Specificity | CELF4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CELF4 polyclonal antibody, unconjugated |
Immunogen | BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI |
Other Names | A230070D14Rik|BRUNOL-4|Brul4|Brunol4|C130060B05Rik|CELF-4|CUG-BP- and ETR-3-like factor 4|CUGBP Elav-like family member 4|RNA-binding protein BRUNOL-4|bruno-like 4|RNA binding protein|bruno-like protein 4|CUGBP, Elav-like family member 4|Celf4|zgc:92761|RNA binding protein Bruno-like 4|CUGBP, Elav-like family member 4 L homeolog|celf4.L|Bruno -like 4|CUG-BP and ETR-3 like factor 4|LYST-interacting protein LIP9|RNA-binding protein BRUNOL4|LOC100732038|CUG-BP and ETR-3-like factor 4 |
Gene, Accession # | Gene ID: 56853, 108013, 307540 |
Catalog # | ABIN633349 |
Price | $1020 |
Order / More Info | CELF4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |