Edit |   |
---|---|
Antigenic Specificity | SYCP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SYCP1 polyclonal antibody, unconjugated |
Immunogen | SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV |
Other Names | CT8|HOM-TES-14|SCP1|SCP-1|cancer estis antigen 8|synaptonemal complex protein 1|SYCP1|T16E15.12|T16E15_12|ZYP1|Myosin heavy chain-related protein|ZYP1a|synaptonemal complex protein 1-like|A coiled-coil related protein specific for synapsed regions of meiotic prophase chromosomes|syn1|Meiotic chromosome synaptic protein|LOW QUALITY PROTEIN: synaptonemal complex protein 1 |
Gene, Accession # | Gene ID: 6847 |
Catalog # | ABIN634180 |
Price | $1020 |
Order / More Info | SYCP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |