Edit |   |
---|---|
Antigenic Specificity | LINGO4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LINGO4 polyclonal antibody, unconjugated |
Immunogen | LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT |
Other Names | A530050P17Rik|LERN4|Lrrn6d|leucine rich repeat neuronal 6D|leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4|leucine-rich repeat neuronal protein 6D|leucine rich repeat and Ig domain containing 4|Lingo4|RGD1562025|DAAT9248|PRO34002|leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4|zgc:198379|leucine rich repeat and Ig domain containing 4b|lingo4b |
Gene, Accession # | Gene ID: 320747, 339398, 499668 |
Catalog # | ABIN635071 |
Price | $1020 |
Order / More Info | LINGO4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |