Edit |   |
---|---|
Antigenic Specificity | ELOVL5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ELOVL5 polyclonal antibody, unconjugated |
Immunogen | ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
Other Names | HELO1|dJ483K16.1|3-keto acyl-CoA synthase ELOVL5|ELOVL FA elongase 5|ELOVL family member 5|elongation of long chain fatty acids (FEN1Elo2|SUR4Elo3-like|yeast)|elongation of very long chain fatty acids protein 5|fatty acid elongase 1|homolog of yeast long chain polyunsaturated fatty acid elongatio|homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2|very-long-chain 3-oxoacyl-CoA synthase 5|ELOVL fatty acid elongase 5|ELOVL5|1110059L23Rik|AI747313|AU043003|homolog of yeast long chain polyunsaturated fatty acid elongation enzyme|ELOVL family member 5, elongation of long chain fatty acids (yeast)|rELO1|elongation of long chain fatty acids|elongation of long chain fatty acids family member 5|elongation of very long chain fatty acids-like 5|zgc:63549|elongation of very long chain fatty acids protein|elovl2|SUR4Elo3-like)|elongation of very long chain fatty acids (FEN1Elo2|SUR4Elo3|yeast)-like 2|elongation of very long chain fatty acids-like 2|ELOVL fatty acid elongase 5 S homeolog|elovl5.S|LOW QUALITY PROTEIN: elongation of very long chain fatty acids protein 5 |
Gene, Accession # | Gene ID: 60481, 68801 |
Catalog # | ABIN635023 |
Price | $1020 |
Order / More Info | ELOVL5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |