Edit |   |
---|---|
Antigenic Specificity | SIGLEC12 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SIGLEC12 polyclonal antibody, unconjugated |
Immunogen | SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV |
Other Names | S2V|SIGLECL1|SLG|Siglec-XII|SIGLEC-like 1|sialic acid-binding Ig-like lectin 12|sialic acid-binding Ig-like lectin-like 1|sialic acid binding Ig like lectin 12 (gene/pseudogene)|SIGLEC12|Sialic Acid Binding Ig-Like Lectin 12|sialic acid binding immunoglobulin-like lectin-like protein 1|sialic acid-binding lectin Siglec-L1|siglec-12|siglec-L1|sialic acid binding Ig like lectin 12 |
Gene, Accession # | Gene ID: 89858 |
Catalog # | ABIN634721 |
Price | $1020 |
Order / More Info | SIGLEC12 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |