Edit |   |
---|---|
Antigenic Specificity | LSM6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LSM6 polyclonal antibody, unconjugated |
Immunogen | LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE |
Other Names | YDR378C|Sm protein F|U6 snRNA-associated Sm-like protein LSm6|LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated|LSM6|LSM6 Homolog, U6 Small Nuclear RNA Associated|LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog|lsm6.S|1500031N17Rik|2410088K19Rik|AI747288|RGD1561937|zgc:92379|LSM6 homolog|U6 small nuclear RNA associated |
Gene, Accession # | Gene ID: 11157, 78651, 498934 |
Catalog # | ABIN633347 |
Price | $1020 |
Order / More Info | LSM6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |