Edit |   |
---|---|
Antigenic Specificity | LRRC4C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LRRC4C polyclonal antibody, unconjugated |
Immunogen | LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE |
Other Names | 6430556C10Rik|NGL-1|mKIAA1580|leucine-rich repeat-containing protein 4C|netrin g1 ligand|netrin-G1 ligand|leucine rich repeat containing 4C|Lrrc4c|RGD1311013|fd12d10|wu:fd12d10|zgc:110565|NGL1 |
Gene, Accession # | Gene ID: 241568, 311236 |
Catalog # | ABIN635150 |
Price | $1020 |
Order / More Info | LRRC4C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |