Edit |   |
---|---|
Antigenic Specificity | WASF3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-WASF3 polyclonal antibody, unconjugated |
Immunogen | WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK |
Other Names | Brush-1|SCAR3|WAVE3|WASP family Verprolin-homologous protein 3|WASP family protein member 3|protein WAVE-3|verprolin homology domain-containing protein 3|wiskott-Aldrich syndrome protein family member 3|WAS protein family member 3|WASF3|WAS Protein Family, Member 3|wu:fb74d08|wu:fi28e02|zgc:158236|WAS protein family, member 3b|wasf3b |
Gene, Accession # | Gene ID: 10810 |
Catalog # | ABIN631248 |
Price | $1020 |
Order / More Info | WASF3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |