Edit |   |
---|---|
Antigenic Specificity | DLC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DLC1 polyclonal antibody, unconjugated |
Immunogen | DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL |
Other Names | ARHGAP7|HP|STARD12|p122-RhoGAP|Rho-GTPase-activating protein 7|START domain-containing protein 12|StAR-related lipid transfer (START) domain containing 12|deleted in liver cancer 1 protein|deleted in liver cancer 1 variant 2|rho GTPase-activating protein 7|rho-type GTPase-activating protein 7|DLC1 Rho GTPase activating protein|DLC1|Deleted in Liver Cancer 1|rhogap7|DLC1 Rho GTPase activating protein S homeolog|dlc1.S|DLC-1|deleted in liver cancer 1 protein homolog|stAR-related lipid transfer protein 12|rho GTPase-activating protein 7-like|LOC100456847|A730069N07Rik|RhoGAP|rho GTPase activating protein 7|LOC100729904 |
Gene, Accession # | Gene ID: 10395, 50768, 58834 |
Catalog # | ABIN630519 |
Price | $1020 |
Order / More Info | DLC1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |