Edit |   |
---|---|
Antigenic Specificity | KANK3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KANK3 polyclonal antibody, unconjugated |
Immunogen | ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR |
Other Names | ANKRD47|KN motif and ankyrin repeat domains 3|ankyrin repeat domain 47|KANK3|KN motif and ankyrin repeat domain-containing protein 3|0610013D04Rik|D17Ertd288e|NG28|ankyrin repeat domain-containing protein 47|RGD1308853|kidney ankyrin repeat-containing protein 3 |
Gene, Accession # | Gene ID: 80880, 256949, 366848 |
Catalog # | ABIN631860 |
Price | $1020 |
Order / More Info | KANK3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |