Edit |   |
---|---|
Antigenic Specificity | KCNJ5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KCNJ5 polyclonal antibody, unconjugated |
Immunogen | KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ |
Other Names | CIR|GIRK4|KATP1|KIR3.4|LQT13|G protein-activated inward rectifier potassium channel 4|IRK-4|cardiac ATP-sensitive potassium channel|heart KATP channel|inward rectifier K+ channel KIR3.4|potassium voltage-gated channel subfamily J member 5|KCNJ5|Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5|GIRK-4|KATP-1|cardiac inward rectifier|inward rectifier K(+) channel Kir3.4|potassium channel|inwardly rectifying subfamily J member 5|inward rectifying K channel|potassium inwardly-rectifying channel J5|potassium inwardly-rectifying channel|subfamily J|member 5 |
Gene, Accession # | Gene ID: 3762 |
Catalog # | ABIN633707 |
Price | $1020 |
Order / More Info | KCNJ5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |