Edit |   |
---|---|
Antigenic Specificity | ERP29 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ERP29 polyclonal antibody, unconjugated |
Immunogen | ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
Other Names | C12orf8|ERp28|ERp31|PDI-DB|PDIA9|endoplasmic reticulum lumenal protein ERp28|endoplasmic reticulum resident protein 28|endoplasmic reticulum resident protein 29|endoplasmic reticulum resident protein 31|protein disulfide isomerase family A|member 9|endoplasmic reticulum protein 29|ERP29|1200015M03Rik|2810446M09Rik|AW209030|endoplasmic reticulum protein ERp29|endoplasmic retuclum protein 29|ERp28 protein |
Gene, Accession # | Gene ID: 10961 |
Catalog # | ABIN635286 |
Price | $1020 |
Order / More Info | ERP29 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |