Edit |   |
---|---|
Antigenic Specificity | SSB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SSB polyclonal antibody, unconjugated |
Immunogen | SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL |
Other Names | LARP3|La|La ribonucleoprotein domain family|member 3|SS-B|SS-BLa protein|autoantigen La|la autoantigen|lupus La antigen|lupus La protein|sjoegren syndrome type B antigen|Sjogren syndrome antigen B|SSB|la autoantigen homolog|la ribonucleoprotein|lupus La protein homolog|lab1|la autoantigen homolog B|la ribonucleoprotein B|lupus La protein homolog B|Sjogren syndrome antigen B L homeolog|ssb.L|Mt-SSB|MtSSB|Ssbp1|single-stranded DNA binding|single-stranded DNA-binding protein|mitochondrial|single stranded DNA binding protein 1|La protein|Lupus LA protein homolog (LA ribonucleoprotein) (LA autoantigen homolog)|mRNA for autoantigen|wu:fb17f11|zgc:55588|Sjogren syndrome antigen B (autoantigen La) |
Gene, Accession # | Gene ID: 6741, 20823, 81783, 478787 |
Catalog # | ABIN633464 |
Price | $1020 |
Order / More Info | SSB Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |