Edit |   |
---|---|
Antigenic Specificity | GAPVD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GAPVD1 polyclonal antibody, unconjugated |
Immunogen | GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ |
Other Names | GAPEX5|RAP6|GAPex-5|GTPase-activating protein and VPS9 domain-containing protein 1|rab5-activating protein 6|GTPase activating protein and VPS9 domains 1|GAPVD1|zgc:92666|LOAG_00609|2010005B09Rik|4432404J10Rik|AW108497|RME-6|mKIAA1521|RGD1307479|GTPase activating protein and VPS9 domains 1 S homeolog|gapvd1.S|LOC100516057|LOW QUALITY PROTEIN: GTPase-activating protein and VPS9 domain-containing protein 1 |
Gene, Accession # | Gene ID: 26130, 66691, 311880, 480725 |
Catalog # | ABIN630695 |
Price | $1020 |
Order / More Info | GAPVD1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |