Edit |   |
---|---|
Antigenic Specificity | GLUD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GLUD1 polyclonal antibody, unconjugated |
Immunogen | GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Other Names | GDH|GDH 1|glutamate dehydrogenase 1|mitochondrial|GLUD1|gdh1|mitochondrial glutamate dehydrogenase 1|glutamate dehydrogenase 1 S homeolog|glud1.S|glutamate dehydrogenase 1, mitochondrial|LOC693461|cb719|wu:fb16e02|wu:fb58f12|wu:fe37f03|wu:fj43f02|zgc:192851|zgc:55630|glutamate dehydrogenase 1b|glud1b|GLUD|glutamate dehydrogenase (NAD(P)+)|AI118167|Gdh-X|Gludl|Ac2-281|Gludeha|MRG-2|memory-related gene 2 protein|GLUTAMATE DECARBOXYLASE 1|MRG7.13|MRG7_13|glutamate dehydrogenase|HACJB3_RS00320|mitochondrial-like|LOC100587725|C2H1orf130|non-compact myelin associated protein|NCMAP|legdh1|NADH-glutamate dehydrogenase |
Gene, Accession # | Gene ID: 2894 |
Catalog # | ABIN631169 |
Price | $1020 |
Order / More Info | GLUD1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |