Edit |   |
---|---|
Antigenic Specificity | CHEK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CHEK1 polyclonal antibody, unconjugated |
Immunogen | CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL |
Other Names | CHK1|CHK1 checkpoint homolog|Checkpoint|S. pombe|homolog of|1|Chk1-S|cell cycle checkpoint kinase|checkpoint kinase-1|serine hreonine-protein kinase Chk1|checkpoint kinase 1|CHEK1|C85740|rad27|checkpoint kinase 1 homolog|rad27 homolog|integral membrane protein 1|Chk1 checkpoint kinase|xChk1|checkpoint kinase 1 S homeolog|chek1.S|An08g10320|serine/threonine-protein kinase chk1|ANI_1_2436074|AO090003000441|AOR_1_768154|PTRG_04183|CAMK/CAMKL/CHK1 protein kinase Chk1|SJAG_01680|PAAG_04978|MCYG_03290|VDBG_03742|id:ibd2720|zgc:56093|2720|Serine hreonine-protein kinase Chk1-like protein|Chk1 protein kinase |
Gene, Accession # | Gene ID: 1111, 12649, 140583, 609767 |
Catalog # | ABIN634171 |
Price | $1020 |
Order / More Info | CHEK1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |