Edit |   |
---|---|
Antigenic Specificity | EXOSC3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EXOSC3 polyclonal antibody, unconjugated |
Immunogen | EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK |
Other Names | PCH1B|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp-40|p10|exosome complex component RRP40|exosome complex exonuclease RRP40|ribosomal RNA-processing protein 40|exosome component 3|EXOSC3|2310005D06Rik|AI593501|im:7140537|zgc:112345|exosome component 3 L homeolog|exosc3.L|LOW QUALITY PROTEIN: exosome complex component RRP40 |
Gene, Accession # | Gene ID: 51010, 66362, 313243, 481616 |
Catalog # | ABIN633267 |
Price | $1020 |
Order / More Info | EXOSC3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |