Edit |   |
---|---|
Antigenic Specificity | Olfactomedin 4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Olfactomedin 4 polyclonal antibody, unconjugated |
Immunogen | OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Other Names | GC1|GW112|OLM4|OlfD|UNQ362|bA209J19.1|hGC-1|hOLfD|G-CSF-stimulated clone 1 protein|antiapoptotic protein GW112|olfactomedin-4|olfactomedin 4|OLFM4|Gm296|Gm913|pPD4|PU.1 difference product 4|tiarin|olfactomedin 4 L homeolog|olfm4.L|olfactomedin-4-like|LOC100225360 |
Gene, Accession # | Gene ID: 10562 |
Catalog # | ABIN630153 |
Price | $902 |
Order / More Info | Olfactomedin 4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |