Edit |   |
---|---|
Antigenic Specificity | G3BP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-G3BP1 polyclonal antibody, unconjugated |
Immunogen | G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE |
Other Names | G3BP|HDH-VIII|ATP-dependent DNA helicase VIII|G3BP-1|GAP SH3 domain-binding protein 1|GAP binding protein|Ras-GTPase-activating protein SH3-domain-binding protein|RasGAP-associated endoribonuclease G3BP|ras GTPase-activating protein-binding protein 1|G3BP stress granule assembly factor 1|G3BP1|GTPase Activating Protein (SH3 Domain) Binding Protein 1|fj17h05|zgc:56034|wu:fj17h05|MGC53271|GTPase activating protein (SH3 domain) binding protein 1 L homeolog|g3bp1.L|ATP-dependent DNARNA helicase G3BP|LOC100304885|RGD1310666|Ras-GTPase-activating protein SH3-domain binding protein 1|AI849976|B430204O07|C87777|mKIAA4115|GAP SH3 binding protein |
Gene, Accession # | Gene ID: 10146, 27041, 479322 |
Catalog # | ABIN630227 |
Price | $902 |
Order / More Info | G3BP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |