Edit |   |
---|---|
Antigenic Specificity | ATP6V1B2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP6V1B2 polyclonal antibody, unconjugated |
Immunogen | ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG |
Other Names | ATP6B1B2|ATP6B2|HO57|VATB|VPP3|Vma2|H+ transporting two-sector ATPase|V-ATPase B2 subunit|V-ATPase subunit B 2|V-type proton ATPase subunit B|brain isoform|endomembrane proton pump 58 kDa subunit|vacuolar H+-ATPase 56|000 subunit|vacuolar proton pump subunit B 2|ATPase H+ transporting V1 subunit B2|ATP6V1B2|ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2|AI194269|AI790362|R74844|ATPase|H+ transporting|V1 subunit B|lysosomal (vacuolar proton pump)|beta 5658 kDa|lysosomal 5658kD|lysosomal 5658kDa|ATPase, H+ transporting, lysosomal V1 subunit B2|vacuolar H+ATPase B2|atp6v1bb|fj51e01|vatB2|wu:fj51e01|zgc:109771|V1 subunit B2|lysosomal|member b|ATPase, H+ transporting, lysosomal, V1 subunit B2|vha55|ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2 S homeolog|atp6v1b2.S|vacuolar H-ATPase B subunit osteoclast isozyme|H+-ATPase B subunit|H+-ATPase non-catalytic subunit B|vacuolar H+-ATPase|Vacuolar ATP synthase subunit B |
Gene, Accession # | Gene ID: 526, 11966, 117596 |
Catalog # | ABIN631079 |
Price | $1020 |
Order / More Info | ATP6V1B2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |