Edit |   |
---|---|
Antigenic Specificity | SPNS1/Spinster 1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SPNS1/Spinster 1 polyclonal antibody, unconjugated |
Immunogen | SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT |
Other Names | HSpin1|LAT|PP2030|SPIN1|SPINL|nrs|protein spinster homolog 1|spinster-like protein 1|sphingolipid transporter 1 (putative)|SPNS1|Spinster Homolog 1|SPNS1/Spinster 1|CD19 antigen|spinster homolog 1 (Drosophila)|2210013K02Rik|spinster-like protein|RGD1305613|sphingolipid transporter 1|spinster homolog 1 L homeolog|spns1.L|spinster|etID64740.3|wu:fb95b12|wu:fi37e11|not really started|protein not really started |
Gene, Accession # | Gene ID: 73658, 361648 |
Catalog # | ABIN635490 |
Price | $1020 |
Order / More Info | SPNS1/Spinster 1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |