Edit |   |
---|---|
Antigenic Specificity | RBBP7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RBBP7 polyclonal antibody, unconjugated |
Immunogen | RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH |
Other Names | RbAp46|G1S transition control protein-binding protein RbAp46|RBBP-7|histone acetyltransferase type B subunit 2|histone-binding protein RBBP7|nucleosome-remodeling factor subunit RBAP46|retinoblastoma-binding protein 7|retinoblastoma-binding protein RbAp46|retinoblastoma-binding protein p46|RB binding protein 7, chromatin remodeling factor|RBBP7|Retinoblastoma Binding Protein 7|AA409861|AI173248|AU019541|BB114024|mRbAp46|G1S transition control protein-binding protein|retinoblastoma binding protein 7, chromatin remodeling factor|retinoblastoma binding protein 7 L homeolog|rbbp7.L|Rbap46 polypeptide|histone-binding protein RBBP7-like|Caf1|wu:fa13g08|wu:fb50h10|wu:fc29d09|zgc:56477|zgc:85617|retinoblastoma binding protein 4, like|rbb4l|LOC108708306|CaO19.2146|Hat2p|HAT2 |
Gene, Accession # | Gene ID: 5931, 83712, 245688 |
Catalog # | ABIN630697 |
Price | $1020 |
Order / More Info | RBBP7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |