Edit |   |
---|---|
Antigenic Specificity | SLC11A2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC11A2 polyclonal antibody, unconjugated |
Immunogen | SLC11 A2 antibody was raised using the N terminal Of Slc11 2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
Other Names | DCT1|DMT1|NRAMP2|DMT-1|NRAMP 2|divalent cation transporter 1|natural resistance-associated macrophage protein 2|solute carrier family 11 (proton-coupled divalent metal ion transporters)|member 2|solute carrier family 11 member 2|SLC11A2|Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2|divalent metal transporter 1|mk|van|microcytic anemia|viable anaemia|Solute carrier family 11 member 2 (natural resistance-associated macrophage protein 2)|ATNRAMP2|F8G22.4|F8G22_4|NRAMP metal ion transporter 2|manganese transport protein|metal transporter Nramp2|LOC9327403|cb426|fa07b10|wu:fa07b10|zgc:136699|cdy|chardonnay|nramp|solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 |
Gene, Accession # | Gene ID: 4891 |
Catalog # | ABIN635359 |
Price | $1020 |
Order / More Info | SLC11A2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |