Edit |   |
---|---|
Antigenic Specificity | SUN2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SUN2 polyclonal antibody, unconjugated |
Immunogen | UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM |
Other Names | UNC84B|SUN domain-containing protein 2|Sad1 unc-84 domain protein 2|nuclear envelope protein|protein unc-84 homolog B|rab5-interacting protein|rab5IP|sad1unc-84 protein-like 2|unc-84 homolog B|Sad1 and UNC84 domain containing 2|SUN2|B230369L08Rik|C030011B15|RGD1563141 |
Gene, Accession # | Gene ID: 25777, 315135 |
Catalog # | ABIN634274 |
Price | $1020 |
Order / More Info | SUN2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |