Edit |   |
---|---|
Antigenic Specificity | beta Defensin 1 |
Clone | M11-14b-D10 |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG1 |
Format | unconjugated |
Size | 10 µg |
Concentration | n/a |
Applications | ELISA, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-beta Defensin 1 monoclonal antibody, unconjugated |
Immunogen | Synthetic human beta-Defensin 1 (AA 1-36). (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK) |
Other Names | BD1|DEFB-1|DEFB101|HBD1|BD-1|beta-defensin 1|beta-defensin-1|defensin beta 1|DEFB1|Defensin, beta 1|beta Defensin 1|AW260221|rBD-1|Gal 1|Gal 1-alpha|antimicrobial peptide 1|antimicrobial peptide CHP2|chicken heterophil peptide 2|gal-1 alpha|gallinacin-1 alpha|avian beta-defensin 1|AvBD1|DEFB1-like|cBD1|RHBD-1|beta defensin-1 homolog|PBD-1|prepro-beta-defensin 1|Defensin|beta 1|beta-defensin 1-like|LOC100861170|BNBD-1|DEFB1-like protein |
Gene, Accession # | Gene ID: 1672 |
Catalog # | ABIN234969 |
Price | $492 |
Order / More Info | beta Defensin 1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |