Edit |   |
---|---|
Antigenic Specificity | LRP2BP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LRP2BP polyclonal antibody, unconjugated |
Immunogen | LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE |
Other Names | LRP2-binding protein|megBP|megalin-binding protein|LRP2 binding protein|LRP2BP|1700113N17Rik|2310006J04Rik|4930479L12Rik|RGD1305896|low density lipoprotein receptor-related protein 2 binding protein|LRP2-binding protein-like|zgc:165631|LRP2 binding protein S homeolog|lrp2bp.S |
Gene, Accession # | Gene ID: 67620, 290753, 353322, 475628 |
Catalog # | ABIN632431 |
Price | $1020 |
Order / More Info | LRP2BP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |