Edit |   |
---|---|
Antigenic Specificity | HNRNPAB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPAB polyclonal antibody, unconjugated |
Immunogen | HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK |
Other Names | fd36h02|wu:fd36h02|heterogeneous nuclear ribonucleoprotein AB|heterogeneous nuclear ribonucleoprotein A/Bb|hnrnpabb|Heterogeneous Nuclear Ribonucleoprotein A/B|HNRNPAB|ABBP1|HNRPAB|ABBP-1|APOBEC1-binding protein 1|apobec-1 binding protein 1|apolipoprotein B mRNA editing enzyme|catalytic polypeptide 1-binding protein 1|hnRNP AB|hnRNP type AB protein|3010025C11Rik|CBF-A|Cgbfa|CArG-binding factor-A|S1 protein D2|A1F-C1|hm:zeh1271|wu:fa18g02|wu:fb07b06|wu:fb16c05|zeh1271|heterogeneous nuclear ribonucleoprotein A/Ba|hnrnpaba|heterogeneous nuclear ribonucleoprotein A/B L homeolog|hnrnpab.L|ribonucleoprotein|single stranded D box binding factor|CArG-binding factor A|hnRNP type AB related protein |
Gene, Accession # | Gene ID: 3182, 15384 |
Catalog # | ABIN633238 |
Price | $1020 |
Order / More Info | HNRNPAB Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |