Edit |   |
---|---|
Antigenic Specificity | C17orf57 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C17orf57 polyclonal antibody, unconjugated |
Immunogen | C17 ORF57 antibody was raised using the N terminal Of C17 rf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL |
Other Names | C17orf57|EF-hand calcium-binding domain-containing protein 13|EF-hand domain-containing protein C17orf57|EF-hand calcium binding domain 13|EFCAB13|Chromosome 17 Open Reading Frame 57 |
Gene, Accession # | Gene ID: 124989 |
Catalog # | ABIN632216 |
Price | $1020 |
Order / More Info | C17orf57 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |