Edit |   |
---|---|
Antigenic Specificity | HBXIP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | hepatitis b virus (hbv) |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HBXIP polyclonal antibody, unconjugated |
Immunogen | HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR |
Other Names | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5|LAMTOR5|Hepatitis B Virus X-Interacting Protein|HBXIP|hepatitis B virus x interacting protein|HBV X-interacting protein homolog|HBX-interacting protein homolog|hepatitis B virus X-interacting protein homolog|late endosomallysosomal adaptor and MAPK and MTOR activator 5|ragulator complex protein LAMTOR5|1110003H18Rik|XIP|HBV X-interacting protein|HBx-interacting protein|hepatitis B virus x-interacting protein (9.6kD)|late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 S homeolog|lamtor5.S |
Gene, Accession # | Gene ID: 10542, 68576 |
Catalog # | ABIN630790 |
Price | $1020 |
Order / More Info | HBXIP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |