Edit |   |
---|---|
Antigenic Specificity | ARPC3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ARPC3 polyclonal antibody, unconjugated |
Immunogen | ARPC3 antibody was raised using the N terminal of ARPC3 corresponding to a region with amino acids MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK |
Other Names | ARC21|p21-Arc|ARP23 protein complex subunit p21|actin-related protein 23 complex subunit 3|arp23 complex 21 kDa subunit|actin related protein 2/3 complex subunit 3|ARPC3|Actin Related Protein 2/3 Complex, Subunit 3, 21kDa|1110006A04Rik|21kDa|AA408672|AI788639|p21-Ar|p21Arc|Arp23 complex subunit p21-Arc|actin related protein 2/3 complex, subunit 3|actin related protein 2/3 complex subunit 3 L homeolog|arpc3.L|actin related protein 23 complex subunit 3|actin related protein 23 complex|subunit 3|actin related protein 2/3 complex subunit 3 pseudogene|LOC738738|zgc:86828|actin-related protein 2/3 complex subunit 3|LOC100036831 |
Gene, Accession # | Gene ID: 10094, 56378, 288669 |
Catalog # | ABIN631647 |
Price | $1020 |
Order / More Info | ARPC3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |