Edit |   |
---|---|
Antigenic Specificity | EEF2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | C. elegans, Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EEF2 polyclonal antibody, unconjugated |
Immunogen | EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND |
Other Names | EEF-2|EF-2|EF2|elongation factor 2|polypeptidyl-tRNA translocase|eukaryotic translation elongation factor 2|EEF2|elongation factor-2|MGC76191|MGC79628|eukaryotic translation elongation factor 2, gene 1|eef2.1|POSPLDRAFT_118836|elongation factor 2-like|eef2l|fe49h02|wu:fe49h02|zgc:63584|like|eukaryotic translation elongation factor 2b|eef2b|zef2|ETS-related factor2|LOW QUALITY PROTEIN: elongation factor 2|CG2238|DmelCG2238|EF-2b|EF2B|anon-EST:Liang-1.44|chr2L:21668915..21669164|clone 1.44|CG2238 gene product from transcript CG2238-RD|CG2238-PA|CG2238-PC|CG2238-PD|EF2-PA|EF2-PC|EF2-PD|elongation factor 2b |
Gene, Accession # | Gene ID: 1938, 13629, 29565, 35422, 172743 |
Catalog # | ABIN630891 |
Price | $1020 |
Order / More Info | EEF2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |