Edit |   |
---|---|
Antigenic Specificity | TMCO3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TMCO3 polyclonal antibody, unconjugated |
Immunogen | TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL |
Other Names | C13orf11|B230339H12Rik|putative LAG1-interacting protein|transmembrane and coiled-coil domain-containing protein 3|transmembrane and coiled-coil domains 3|TMCO3|C87304|RGD1306586|osteoblast 6D12C protein |
Gene, Accession # | Gene ID: 55002, 306607 |
Catalog # | ABIN635995 |
Price | $1020 |
Order / More Info | TMCO3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |