Edit |   |
---|---|
Antigenic Specificity | IL-10RA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IL-10RA polyclonal antibody, unconjugated |
Immunogen | IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN |
Other Names | AW553859|CDw210|CDw210a|Il10r|mIL-10R|IL-10 receptor subunit alpha|IL-10R subunit 1|IL-10R subunit alpha|IL-10R1|IL-10RA|interleukin-10 receptor subunit 1|interleukin-10 receptor subunit alpha|interleukin 10 receptor, alpha|Il10ra|CD210|CD210a|HIL-10R|interleukin-10 receptor alpha chain|interleukin 10 receptor subunit alpha|IL10R1|interleukin 10 receptor 1|interleukin 10 receptor|alpha|interleukin-10 receptor subunit alpha-like |
Gene, Accession # | Gene ID: 3587 |
Catalog # | ABIN630438 |
Price | $902 |
Order / More Info | IL-10RA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |