Edit |   |
---|---|
Antigenic Specificity | TIM3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | hepatitis a virus (hav) |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TIM3 polyclonal antibody, unconjugated |
Immunogen | HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP |
Other Names | HAVcr-2|KIM-3|TIM3|TIMD-3|TIMD3|Tim-3|T cell immunoglobulin mucin 3|T cell immunoglobulin mucin-3|T-cell immunoglobulin and mucin domain-containing protein 3|T-cell membrane protein 3|kidney injury molecule-3|hepatitis A virus cellular receptor 2|HAVCR2|TIM 3|MGC140131|T-cell immunoglobulin and mucin domain containing 3|hepatitis A virus cellular receptor 2 homolog |
Gene, Accession # | Gene ID: 84868, 171285 |
Catalog # | ABIN635817 |
Price | $1020 |
Order / More Info | TIM3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |