Edit |   |
---|---|
Antigenic Specificity | KCTD7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KCTD7 polyclonal antibody, unconjugated |
Immunogen | KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE |
Other Names | 4932409E18|9430010P06Rik|BTBPOZ domain-containing protein KCTD7|potassium channel tetramerisation domain containing 7|Kctd7|potassium channel tetramerization domain containing 7|CLN14|EPM3|zgc:136884 |
Gene, Accession # | Gene ID: 154881, 212919, 688993 |
Catalog # | ABIN633658 |
Price | $1020 |
Order / More Info | KCTD7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |