Edit |   |
---|---|
Antigenic Specificity | SHPRH |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SHPRH polyclonal antibody, unconjugated |
Immunogen | SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL |
Other Names | bA545I5.2|2610103K11Rik|E3 ubiquitin-protein ligase SHPRH|SNF2|histone-linker|PHD and RING finger domain-containing helicase|SNF2 histone linker PHD RING helicase|SHPRH|SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase|AA450458|AU024614|BC006883|D230017O13Rik|E130018M05 |
Gene, Accession # | Gene ID: 257218 |
Catalog # | ABIN633252 |
Price | $1020 |
Order / More Info | SHPRH Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |