Edit |   |
---|---|
Antigenic Specificity | TYR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TYR polyclonal antibody, unconjugated |
Immunogen | TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM |
Other Names | CMM8|OCA1A|OCAIA|SHEP3|LB24-AB|SK29-AB|monophenol monooxygenase|oculocutaneous albinism IA|tumor rejection antigen AB|tyrosinase|TYR|C|TYRO|hypothetical protein|tyr-5|albino|skc35|albino locus protein|sandy|zgc:109705|oca1|sdy|tyra|tyrosinase (oculocutaneous albinism IA)|tyrosinase S homeolog|tyr.S|Celal_3121|Halhy_4121|Mesop_2736|LOC100136546|tyrosinase-like |
Gene, Accession # | Gene ID: 7299, 22173, 308800, 403405 |
Catalog # | ABIN630459 |
Price | $902 |
Order / More Info | TYR Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |