Edit |   |
---|---|
Antigenic Specificity | EXOSC10 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EXOSC10 polyclonal antibody, unconjugated |
Immunogen | EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
Other Names | PM-Scl|PMScl-100|PMSCL|PMSCL2|RRP6|Rrp6p|p2|p3|p4|P100 polymyositis-scleroderma overlap syndrome-associated autoantigen|autoantigen PM-SCL|autoantigen PMScl 2|polymyositisscleroderma autoantigen 100 kDa|polymyositisscleroderma autoantigen 2 (100kD)|polymyositisscleroderma autoantigen 2|100kDa|exosome component 10|EXOSC10|autoantigen PMScl 2 homolog|polymyositisscleroderma autoantigen 2 homolog|zgc:55695|exosome component 10 L homeolog|exosc10.L|201.t00018|EHI_021400|21.m02990|BBOV_IV002650|CpipJ_CPIJ003896|CMU_031760|DDBDRAFT_0203581|DDBDRAFT_0233752|DDB_0203581|DDB_0233752|3'-5' exonuclease|Tsp_05247 |
Gene, Accession # | Gene ID: 5394 |
Catalog # | ABIN629904 |
Price | $902 |
Order / More Info | EXOSC10 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |